TBCE (NM_003193) Human Mass Spec Standard
CAT#: PH301927
TBCE MS Standard C13 and N15-labeled recombinant protein (NP_003184)
View other "TBCE" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TBCE MS Standard C13 and N15-labeled recombinant protein (NP_003184) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201927 |
Predicted MW | 59.3 kDa |
Protein Sequence |
>RC201927 protein sequence
Red=Cloning site Green=Tags(s) MSDTLTADVIGRRVEVNGEHATVRFAGVVPPVAGPWLGVEWDNPERGKHDGSHEGTVYFKCRHPTGGSFI RPNKVNFGTDFLTAIKNRYVLEDGPEEDRKEQIVTIGNKPVETIGFDSIMKQQSQLSKLQEVSLRNCAVS CAGEKGGVAEACPNIRKVDLSKNLLSSWDEVIHIADQLRHLEVLNVSENKLKFPSGSVLTGTLSVLKVLV LNQTGITWAEVLRCVAGCPGLEELYLESNNIFISERPTDVLQTVKLLDLSSNQLIDENQLYLIAHLPRLE QLILSDTGISSLHFPDAGIGCKTSMFPSLKYLVVNDNQISQWSFFNELEKLPSLRALSCLRNPLTKEDKE AETARLLIIASIGQLKTLNKCEILPEERRRAELDYRKAFGNEWKQAGGHKDPEKNRLSEEFLTAHPRYQF LCLKYGAPEDWELKTQQPLMLKNQLLTLKIKYPHQLDQKVLEKQLPGSMTIQKVKGLLSRLLKVPVSDLL LSYESPKKPGREIELENDLKSLQFYSVENGDCLLVRW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003184 |
RefSeq Size | 1977 |
RefSeq ORF | 1581 |
Synonyms | HRD; KCS; KCS1; pac2; PEAMO |
Locus ID | 6905 |
Cytogenetics | 1q42.3 |
Summary | Cofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418845 | TBCE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421507 | TBCE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY418845 | Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 2 |
CNY 3,080.00 |
|
LY421507 | Transient overexpression lysate of tubulin folding cofactor E (TBCE), transcript variant 1 |
CNY 4,840.00 |
|
PH314027 | TBCE MS Standard C13 and N15-labeled recombinant protein (NP_001072983) |
CNY 19,520.00 |
|
TP301927 | Recombinant protein of human tubulin folding cofactor E (TBCE), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314027 | Recombinant protein of human tubulin folding cofactor E (TBCE), transcript variant 1, 20 µg |
CNY 2,900.00 |