HEBP1 (NM_015987) Human Mass Spec Standard
CAT#: PH301873
HEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_057071)
View other "HEBP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HEBP1 MS Standard C13 and N15-labeled recombinant protein (NP_057071) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201873 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC201873 protein sequence
Red=Cloning site Green=Tags(s) MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTN DKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAK EADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057071 |
RefSeq Size | 1221 |
RefSeq ORF | 567 |
Synonyms | HBP; HEBP |
Locus ID | 50865 |
Cytogenetics | 12p13.1 |
Summary | The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402480 | HEBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402480 | Transient overexpression lysate of heme binding protein 1 (HEBP1) |
CNY 3,080.00 |
|
TP301873 | Recombinant protein of human heme binding protein 1 (HEBP1), 20 µg |
CNY 2,900.00 |