ABHD5 (NM_016006) Human Mass Spec Standard
CAT#: PH301869
ABHD5 MS Standard C13 and N15-labeled recombinant protein (NP_057090)
View other "ABHD5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ABHD5 MS Standard C13 and N15-labeled recombinant protein (NP_057090) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201869 |
Predicted MW | 39.1 kDa |
Protein Sequence |
>RC201869 protein sequence
Red=Cloning site Green=Tags(s) MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057090 |
RefSeq Size | 5370 |
RefSeq ORF | 1047 |
Synonyms | CGI58; IECN2; NCIE2 |
Locus ID | 51099 |
Cytogenetics | 3p21.33 |
Summary | The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. [provided by RefSeq, Jul 2008] |
Protein Families | Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402485 | ABHD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402485 | Transient overexpression lysate of abhydrolase domain containing 5 (ABHD5) |
CNY 3,080.00 |
|
TP301869 | Recombinant protein of human abhydrolase domain containing 5 (ABHD5), 20 µg |
CNY 2,900.00 |