FADD (NM_003824) Human Mass Spec Standard
CAT#: PH301805
FADD MS Standard C13 and N15-labeled recombinant protein (NP_003815)
View other "FADD" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | FADD MS Standard C13 and N15-labeled recombinant protein (NP_003815) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201805 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC201805 protein sequence
Red=Cloning site Green=Tags(s) MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASL RRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTER VRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003815 |
RefSeq Size | 1855 |
RefSeq ORF | 624 |
Synonyms | GIG3; MORT1 |
Locus ID | 8772 |
Cytogenetics | 11q13.3 |
Summary | The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Apoptosis, Pathways in cancer, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401265 | FADD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401265 | Transient overexpression lysate of Fas (TNFRSF6)-associated via death domain (FADD) |
CNY 3,080.00 |
|
TP301805 | Recombinant protein of human Fas (TNFRSF6)-associated via death domain (FADD), 20 µg |
CNY 2,900.00 |