HDJ2 (DNAJA1) (NM_001539) Human Mass Spec Standard
CAT#: PH301628
DNAJA1 MS Standard C13 and N15-labeled recombinant protein (NP_001530)
View other "HDJ2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DNAJA1 MS Standard C13 and N15-labeled recombinant protein (NP_001530) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201628 |
Predicted MW | 44.9 kDa |
Protein Sequence |
>RC201628 protein sequence
Red=Cloning site Green=Tags(s) MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKKRELYDKGGEQ AIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGR GGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMECQGHGERISPKDRCKSCNGRKIVREKKILEV HIDKGMKDGQKITFHGEGDQEPGLEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTL DNRTIVITSHPGQIVKHGDIKCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERK EVEETDEMDQVELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001530 |
RefSeq Size | 1538 |
RefSeq ORF | 1191 |
Synonyms | DJ-2; DjA1; hDJ-2; HDJ2; HSDJ; HSJ-2; HSJ2; HSPF4; NEDD7 |
Locus ID | 3301 |
Cytogenetics | 9p21.1 |
Summary | This gene encodes a member of the DnaJ family of proteins, which act as heat shock protein 70 cochaperones. Heat shock proteins facilitate protein folding, trafficking, prevention of aggregation, and proteolytic degradation. Members of this family are characterized by a highly conserved N-terminal J domain, a glycine/phenylalanine-rich region, four CxxCxGxG zinc finger repeats, and a C-terminal substrate-binding domain. The J domain mediates the interaction with heat shock protein 70 to recruit substrates and regulate ATP hydrolysis activity. In humans, this gene has been implicated in positive regulation of virus replication through co-option by the influenza A virus. Several pseudogenes of this gene are found on other chromosomes. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400586 | DNAJA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400586 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily A, member 1 (DNAJA1) |
CNY 3,080.00 |
|
TP301628 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily A, member 1 (DNAJA1), 20 µg |
CNY 2,900.00 |