DNAJB6 (NM_005494) Human Mass Spec Standard
CAT#: PH301620
DNAJB6 MS Standard C13 and N15-labeled recombinant protein (NP_005485)
View other "DNAJB6" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | DNAJB6 MS Standard C13 and N15-labeled recombinant protein (NP_005485) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201620 |
Predicted MW | 26.9 kDa |
Protein Sequence |
>RC201620 protein sequence
Red=Cloning site Green=Tags(s) MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE NGQERVEVEEDGQLKSLTINGKEQLLRLDNK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005485 |
RefSeq Size | 1568 |
RefSeq ORF | 723 |
Synonyms | DJ4; DnaJ; HHDJ1; HSJ-2; HSJ2; LGMD1D; LGMD1E; LGMDD1; MRJ; MSJ-1 |
Locus ID | 10049 |
Cytogenetics | 7q36.3 |
Summary | This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409211 | DNAJB6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417262 | DNAJB6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409211 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 1 |
CNY 3,080.00 |
|
LY417262 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2 |
CNY 3,080.00 |
|
TP301620 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2, 20 µg |
CNY 2,900.00 |