ARL5A (NM_001037174) Human Mass Spec Standard
CAT#: PH301516
ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251)
View other "ARL5A" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_001032251) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201516 |
Predicted MW | 20.73 kDa |
Protein Sequence |
>RC201516 representing NM_001037174
Red=Cloning site Green=Tags(s) MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032251 |
RefSeq Size | 2913 |
RefSeq ORF | 537 |
Synonyms | ARFLP5; ARL5 |
Locus ID | 26225 |
Cytogenetics | 2q23.3 |
Summary | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415981 | ARL5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421930 | ARL5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415981 | Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1 |
CNY 3,080.00 |
|
LY421930 | Transient overexpression lysate of ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3 |
CNY 3,080.00 |
|
PH315504 | ARL5A MS Standard C13 and N15-labeled recombinant protein (NP_036229) |
CNY 19,520.00 |
|
TP301516 | Purified recombinant protein of Homo sapiens ADP-ribosylation factor-like 5A (ARL5A), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP315504 | Recombinant protein of human ADP-ribosylation factor-like 5A (ARL5A), transcript variant 1, 20 µg |
CNY 2,900.00 |