HSPC210 (GSKIP) (NM_016472) Human Mass Spec Standard
CAT#: PH301493
C14orf129 MS Standard C13 and N15-labeled recombinant protein (NP_057556)
View other "HSPC210" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C14orf129 MS Standard C13 and N15-labeled recombinant protein (NP_057556) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201493 |
Predicted MW | 15.6 kDa |
Protein Sequence |
>RC201493 protein sequence
Red=Cloning site Green=Tags(s) METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVET KERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057556 |
RefSeq Size | 2251 |
RefSeq ORF | 417 |
Synonyms | C14orf129; HSPC210 |
Locus ID | 51527 |
Cytogenetics | 14q32.2 |
Summary | This gene encodes a protein that is involved as a negative regulator of GSK3-beta in the Wnt signaling pathway. The encoded protein may play a role in the retinoic acid signaling pathway by regulating the functional interactions between GSK3-beta, beta-catenin and cyclin D1, and it regulates the beta-catenin/N-cadherin pool. The encoded protein contains a GSK3-beta interacting domain (GID) in its C-terminus, which is similar to the GID of Axin. The protein also contains an evolutionarily conserved RII-binding domain, which facilitates binding with protein kinase-A and GSK3-beta, enabling its role as an A-kinase anchoring protein. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413970 | GSKIP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413970 | Transient overexpression lysate of chromosome 14 open reading frame 129 (C14orf129) |
CNY 3,080.00 |
|
TP301493 | Recombinant protein of human chromosome 14 open reading frame 129 (C14orf129), 20 µg |
CNY 2,900.00 |
其它HSPC210产品