RASD2 (NM_014310) Human Mass Spec Standard
CAT#: PH301454
RASD2 MS Standard C13 and N15-labeled recombinant protein (NP_055125)
View other "RASD2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RASD2 MS Standard C13 and N15-labeled recombinant protein (NP_055125) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201454 |
Predicted MW | 30.4 kDa |
Protein Sequence |
>RC201454 protein sequence
Red=Cloning site Green=Tags(s) MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLD ILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGN KNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGD AFHPRPFCMRRVKEMDAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCTIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055125 |
RefSeq Size | 3047 |
RefSeq ORF | 798 |
Synonyms | Rhes; TEM2 |
Locus ID | 23551 |
Cytogenetics | 22q12.3 |
Summary | This gene belongs to the Ras superfamily of small GTPases and is enriched in the striatum. The encoded protein functions as an E3 ligase for attachment of small ubiquitin-like modifier (SUMO). This protein also binds to mutant huntingtin (mHtt), the protein mutated in Huntington disease (HD). Sumoylation of mHTT by this protein may cause degeneration of the striatum. The protein functions as an activator of mechanistic target of rapamycin 1 (mTOR1), which in turn plays a role in myelination, axon growth and regeneration. Reduced levels of mRNA expressed by this gene were found in HD patients. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415366 | RASD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415366 | Transient overexpression lysate of RASD family, member 2 (RASD2) |
CNY 3,080.00 |
|
TP301454 | Recombinant protein of human RASD family, member 2 (RASD2), 20 µg |
CNY 2,900.00 |