RAB3C (NM_138453) Human Mass Spec Standard
CAT#: PH301436
RAB3C MS Standard C13 and N15-labeled recombinant protein (NP_612462)
View other "RAB3C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB3C MS Standard C13 and N15-labeled recombinant protein (NP_612462) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201436 |
Predicted MW | 26 kDa |
Protein Sequence |
>RC201436 protein sequence
Red=Cloning site Green=Tags(s) MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ NTRLKETPPPPQPNCAC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612462 |
RefSeq Size | 1030 |
RefSeq ORF | 681 |
Locus ID | 115827 |
Cytogenetics | 5q11.2 |
Summary | This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408603 | RAB3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408603 | Transient overexpression lysate of RAB3C, member RAS oncogene family (RAB3C) |
CNY 3,080.00 |
|
TP301436 | Recombinant protein of human RAB3C, member RAS oncogene family (RAB3C), 20 µg |
CNY 2,900.00 |