PLAT (NM_033011) Human Mass Spec Standard
CAT#: PH301146
PLAT MS Standard C13 and N15-labeled recombinant protein (NP_127509)
View other "PLAT" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | PLAT MS Standard C13 and N15-labeled recombinant protein (NP_127509) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201146 |
Predicted MW | 57.4 kDa |
Protein Sequence |
>RC201146 protein sequence
Red=Cloning site Green=Tags(s) MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQGCSEPRCFNGGTCQQALYFSDFVCQCPEGFAG KCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDS KPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSA QALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQA AIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHK EFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLG CGQKDVPGVYTKVTNYLDWIRDNMRP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_127509 |
RefSeq Size | 3035 |
RefSeq ORF | 1548 |
Synonyms | T-PA; TPA |
Locus ID | 5327 |
Cytogenetics | 8p11.21 |
Summary | This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400338 | PLAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409761 | PLAT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400338 | Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 1 |
CNY 3,080.00 |
|
LY409761 | Transient overexpression lysate of plasminogen activator, tissue (PLAT), transcript variant 3 |
CNY 3,080.00 |
|
TP301146 | Purified recombinant protein of Homo sapiens plasminogen activator, tissue (PLAT), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP761399 | Purified recombinant protein of Human plasminogen activator, tissue (PLAT), transcript variant 3, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
TP762208 | Purified recombinant protein of Human plasminogen activator, tissue (PLAT), transcript variant 1, Ala157-Val426, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,948.00 |