RFC2 (NM_002914) Human Mass Spec Standard
CAT#: PH301138
RFC2 MS Standard C13 and N15-labeled recombinant protein (NP_002905)
View other "RFC2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | RFC2 MS Standard C13 and N15-labeled recombinant protein (NP_002905) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201138 |
Predicted MW | 35.2 kDa |
Protein Sequence |
>RC201138 protein sequence
Red=Cloning site Green=Tags(s) MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVP NIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDSMTDGAQQALRRTMEIYSKTTRFALACNAS DKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFG FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKL EFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002905 |
RefSeq Size | 1657 |
RefSeq ORF | 960 |
Synonyms | RFC40 |
Locus ID | 5982 |
Cytogenetics | 7q11.23 |
Summary | This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405777 | RFC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419017 | RFC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405777 | Transient overexpression lysate of replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 1 |
CNY 3,080.00 |
|
LY419017 | Transient overexpression lysate of replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2 |
CNY 3,080.00 |
|
TP301138 | Recombinant protein of human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP320036 | Purified recombinant protein of human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg |
CNY 2,900.00 |