United States
Germany
Japan
United Kingdom
China
cleavage stimulation factor (CSTF1) (NM_001324) Human Mass Spec Standard
CAT＃: PH301128
CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001315)
View other "cleavage stimulation factor" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001315) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201128 |
| Predicted MW | 48.4 kDa |
| Protein Sequence |
>RC201128 protein sequence
Red=Cloning site Green=Tags(s) MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIG RSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERM LAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRA FKYIQEAEMLRSISFHPSGDFILVGTQHPTLRLYDINTFQCFVSCNPQDQHTDAICSVNYNSSANMYVTG SKDGCIKLWDGVSNRCITTFEKAHDGAEVCSAIFSKNSKYILSSGKDSVAKLWEISTGRTLVRYTGAGLS GRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFR ARFWYRRSTTD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001315 |
| RefSeq Size | 2323 |
| RefSeq ORF | 1293 |
| Synonyms | CstF-50; CstFp50 |
| Locus ID | 1477 |
| Cytogenetics | 20q13.2-q13.31 |
| Summary | This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420000 | CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422380 | CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422381 | CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC425563 | CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425564 | CSTF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420000 | Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2 |
CNY 3,080.00 |
|
| LY422380 | Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 1 |
CNY 4,840.00 |
|
| LY422381 | Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3 |
CNY 4,840.00 |
|
| LY425563 | Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 1 |
CNY 3,080.00 |
|
| LY425564 | Transient overexpression lysate of cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3 |
CNY 3,080.00 |
|
| PH316135 | CSTF1 MS Standard C13 and N15-labeled recombinant protein (NP_001028694) |
CNY 19,520.00 |
|
| TP301128 | Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP316135 | Recombinant protein of human cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa (CSTF1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它cleavage stimulation factor产品
