TMEM70 (NM_017866) Human Mass Spec Standard
CAT#: PH301060
TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336)
View other "TMEM70" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201060 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC201060 protein sequence
Red=Cloning site Green=Tags(s) MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQ IPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPI QIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFT TFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060336 |
RefSeq Size | 2096 |
RefSeq ORF | 780 |
Synonyms | MC5DN2 |
Locus ID | 54968 |
Cytogenetics | 8q21.11 |
Summary | This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413488 | TMEM70 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421778 | TMEM70 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413488 | Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 1 |
CNY 3,080.00 |
|
LY421778 | Transient overexpression lysate of transmembrane protein 70 (TMEM70), transcript variant 2 |
CNY 3,080.00 |
|
TP301060 | Recombinant protein of human transmembrane protein 70 (TMEM70), transcript variant 1, 20 µg |
CNY 2,900.00 |