MXRA8 (NM_032348) Human Mass Spec Standard
CAT#: PH300955
MXRA8 MS Standard C13 and N15-labeled recombinant protein (NP_115724)
View other "MXRA8" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MXRA8 MS Standard C13 and N15-labeled recombinant protein (NP_115724) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200955 |
Predicted MW | 49.1 kDa |
Protein Sequence |
>RC200955 protein sequence
Red=Cloning site Green=Tags(s) MALPSRILLWKLVLLQSSAVLLHSGSSVPAAAGSSVVSESAVSWEAGARAVLRCQSPRMVWTQDRLHDRQ RVLHWDLRGPGGGPARRLLDLYSAGEQRVYEARDRGRLELSASAFDDGNFSLLIRAVEETDAGLYTCNLH HHYCHLYESLAVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQ PPGVPHDRADRLLDLYASGERRAYGPLFLRDRVAVGADAFERGDFSLRIEPLEVADEGTYSCHLHHHYCG LHERRVFHLTVAEPHAEPPPRGSPGNGSSHSGAPGPDPTLARGHNVINVIVPESRAHFFQQLGYVLATLL LFILLLVTVLLAARRRRGGYEYSDQKSGKSKGKDVNLAEFAVAAGDQMLYRSEDIQLDYKNNILKERAEL AHSPLPAKYIDLDKGFRKENCK LEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115724 |
RefSeq Size | 2534 |
RefSeq ORF | 1326 |
Synonyms | ASP3 |
Locus ID | 54587 |
Cytogenetics | 1p36.33 |
Summary | Transmembrane protein which can modulate activity of various signaling pathways, probably via binding to integrin ITGAV:ITGB3 (PubMed:22492581, PubMed:23386276). Mediates heterophilic cell-cell interactions in vitro (By similarity). Inhibits osteoclastogenesis downstream of TNFSF11/RANKL and CSF1, where it may function by attenuating signaling via integrin ITGB3 and MAP kinase p38 (By similarity). Plays a role in cartilage formation where it promotes proliferation and maturation of growth plate chondrocytes (By similarity). Stimulates formation of primary cilia in chondrocytes (By similarity). Enhances expression of genes involved in the hedgehog signaling pathway in chondrocytes, including the hedgehog signaling molecule IHH; may also promote signaling via the PTHLH/PTHrP pathway (By similarity). Plays a role in angiogenesis where it suppresses migration of endothelial cells and also promotes their apoptosis (PubMed:23386276). Inhibits VEGF-induced activation of AKT and p38 MAP kinase in endothelial cells (PubMed:23386276). Also inhibits VTN (vitronectin)-mediated integrin ITGAV:ITGB3 signaling and activation of PTK2/FAK (PubMed:23386276). May play a role in the maturation and maintenance of the blood-brain barrier (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410185 | MXRA8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410185 | Transient overexpression lysate of matrix-remodelling associated 8 (MXRA8) |
CNY 3,080.00 |
|
TP300955 | Recombinant protein of human matrix-remodelling associated 8 (MXRA8), 20 µg |
CNY 2,900.00 |