NUDT9 (NM_198038) Human Mass Spec Standard
CAT#: PH300952
NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155)
View other "NUDT9" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_932155) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200952 |
Predicted MW | 39.1 kDa |
Protein Sequence |
>RC200952 protein sequence
Red=Cloning site Green=Tags(s) MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKENSHNKARTSPY PGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLY EIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDSSGNKIMHPVSGKHILQFVAIKRKDCGEW AIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWM ETEAVNYHDETGEIMDNLMLEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_932155 |
RefSeq Size | 2458 |
RefSeq ORF | 1053 |
Synonyms | NUDT10 |
Locus ID | 53343 |
Cytogenetics | 4q22.1 |
Summary | The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402975 | NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405100 | NUDT9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402975 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1 |
CNY 3,080.00 |
|
LY405100 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3 |
CNY 3,080.00 |
|
PH322894 | NUDT9 MS Standard C13 and N15-labeled recombinant protein (NP_076952) |
CNY 19,520.00 |
|
TP300952 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP322894 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 9 (NUDT9), transcript variant 1, 20 µg |
CNY 2,900.00 |