DNA Polymerase epsilon (POLE3) (NM_017443) Human Mass Spec Standard
CAT#: PH300874
POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139)
View other "DNA Polymerase epsilon" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200874 |
Predicted MW | 16.9 kDa |
Protein Sequence |
>RC200874 protein sequence
Red=Cloning site Green=Tags(s) MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN EEEEVDN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_059139 |
RefSeq Size | 2288 |
RefSeq ORF | 441 |
Synonyms | CHARAC17; CHRAC2; CHRAC17; p17; YBL1 |
Locus ID | 54107 |
Cytogenetics | 9q32 |
Summary | POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004] |
Protein Pathways | Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413749 | POLE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413749 | Transient overexpression lysate of polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3) |
CNY 3,080.00 |
|
TP300874 | Recombinant protein of human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), 20 µg |
CNY 2,900.00 |
其它DNA Polymerase epsilon产品