HYPK (NM_016400) Human Mass Spec Standard
CAT#: PH300840
C15orf63 MS Standard C13 and N15-labeled recombinant protein (NP_057484)
View other "HYPK" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | C15orf63 MS Standard C13 and N15-labeled recombinant protein (NP_057484) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200840 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC200840 protein sequence
Red=Cloning site Green=Tags(s) MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDR RSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057484 |
RefSeq Size | 1351 |
RefSeq ORF | 387 |
Synonyms | C15orf63; HSPC136 |
Locus ID | 25764 |
Cytogenetics | 15q15.3 |
Summary | Has a chaperone-like activity preventing polyglutamine (polyQ) aggregation of HTT. Protects against HTT polyQ-mediated apoptosis in Neuro2a neuronal cells. Required for optimal NAA10-NAA15 complex-mediated N-terminal acetylation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413998 | HYPK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413998 | Transient overexpression lysate of chromosome 15 open reading frame 63 (C15orf63) |
CNY 3,080.00 |
|
TP300840 | Recombinant protein of human Huntingtin interacting protein K (HYPK), 20 µg |
CNY 2,900.00 |