DDA1 (NM_024050) Human Mass Spec Standard
CAT#: PH300826
DDA1 MS Standard C13 and N15-labeled recombinant protein (NP_076955)
View other "DDA1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | DDA1 MS Standard C13 and N15-labeled recombinant protein (NP_076955) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200826 |
Predicted MW | 11.8 kDa |
Protein Sequence |
>RC200826 protein sequence
Red=Cloning site Green=Tags(s) MADFLKGLPVYNKSNFSRFHADSVCKASNRRPSVYLPTREYPSEQIIVTEKTNILLRYLHQQWDKKNAAK KRDQEQVELEGESSAPPRKVARTDSPDMHEDT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_076955 |
RefSeq Size | 4078 |
RefSeq ORF | 306 |
Synonyms | C19orf58; PCIA1 |
Locus ID | 79016 |
Cytogenetics | 19p13.11 |
Summary | May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD-E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411390 | DDA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411390 | Transient overexpression lysate of DET1 and DDB1 associated 1 (DDA1) |
CNY 3,080.00 |
|
TP300826 | Recombinant protein of human DET1 and DDB1 associated 1 (DDA1), 20 µg |
CNY 2,900.00 |