Lysozyme (LYZ) (NM_000239) Human Mass Spec Standard
CAT#: PH300730
LYZ MS Standard C13 and N15-labeled recombinant protein (NP_000230)
View other "Lysozyme" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | LYZ MS Standard C13 and N15-labeled recombinant protein (NP_000230) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200730 |
Predicted MW | 16.5 kDa |
Protein Sequence |
>RC200730 protein sequence
Red=Cloning site Green=Tags(s) MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR QYVQGCGV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000230 |
RefSeq Size | 1516 |
RefSeq ORF | 444 |
Synonyms | LYZF1; LZM |
Locus ID | 4069 |
Cytogenetics | 12q15 |
Summary | This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400091 | LYZ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400091 | Transient overexpression lysate of lysozyme (renal amyloidosis) (LYZ) |
CNY 3,080.00 |
|
TP300730 | Recombinant protein of human lysozyme (renal amyloidosis) (LYZ), 20 µg |
CNY 2,900.00 |
其它Lysozyme产品