PGAM2 (NM_000290) Human Mass Spec Standard
CAT#: PH300701
PGAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000281)
View other "PGAM2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PGAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000281) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200701 |
Predicted MW | 28.8 kDa |
Protein Sequence |
>RC200701 protein sequence
Red=Cloning site Green=Tags(s) MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAI LDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDEKHPYYNSISKER RYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNL PTGIPIVYELNKELKPTKPMQFLGDEETVRKAMEAVAAQGKAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000281 |
RefSeq Size | 888 |
RefSeq ORF | 759 |
Synonyms | GSD10; PGAM-M; PGAMM |
Locus ID | 5224 |
Cytogenetics | 7p13 |
Summary | Phosphoglycerate mutase (PGAM) catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The PGAM is a dimeric enzyme containing, in different tissues, different proportions of a slow-migrating muscle (MM) isozyme, a fast-migrating brain (BB) isozyme, and a hybrid form (MB). This gene encodes muscle-specific PGAM subunit. Mutations in this gene cause muscle phosphoglycerate mutase eficiency, also known as glycogen storage disease X. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424823 | PGAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424823 | Transient overexpression lysate of phosphoglycerate mutase 2 (muscle) (PGAM2) |
CNY 3,080.00 |
|
TP300701 | Recombinant protein of human phosphoglycerate mutase 2 (muscle) (PGAM2), 20 µg |
CNY 2,900.00 |