Cytochrome b5 Outer Mitochondrial Membrane (CYB5B) (NM_030579) Human Mass Spec Standard
CAT#: PH300604
CYB5B MS Standard C13 and N15-labeled recombinant protein (NP_085056)
View other "Cytochrome b5 Outer Mitochondrial Membrane" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CYB5B MS Standard C13 and N15-labeled recombinant protein (NP_085056) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200604 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC200604 protein sequence
Red=Cloning site Green=Tags(s) MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDA SESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYT SESKSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_085056 |
RefSeq Size | 4286 |
RefSeq ORF | 438 |
Synonyms | CYB5-M; CYPB5M; OMB5 |
Locus ID | 80777 |
Cytogenetics | 16q22.1 |
Summary | Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410783 | CYB5B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410783 | Transient overexpression lysate of cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP300604 | Recombinant protein of human cytochrome b5 type B (outer mitochondrial membrane) (CYB5B), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
其它Cytochrome b5 Outer Mitochondrial Membrane产品