Apolipoprotein D (APOD) (NM_001647) Human Mass Spec Standard
CAT#: PH300503
APOD MS Standard C13 and N15-labeled recombinant protein (NP_001638)
View other "Apolipoprotein D" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | APOD MS Standard C13 and N15-labeled recombinant protein (NP_001638) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200503 |
Predicted MW | 21.3 kDa |
Protein Sequence |
>RC200503 protein sequence
Red=Cloning site Green=Tags(s) MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLME NGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQL FHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001638 |
RefSeq Size | 1148 |
RefSeq ORF | 567 |
Locus ID | 347 |
Cytogenetics | 3q29 |
Summary | This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419822 | APOD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419822 | Transient overexpression lysate of apolipoprotein D (APOD) |
CNY 3,080.00 |
|
TP300503 | Recombinant protein of human apolipoprotein D (APOD), 20 µg |
CNY 2,900.00 |
|
TP720686 | Purified recombinant protein of Human apolipoprotein D (APOD) |
CNY 3,140.00 |
其它Apolipoprotein D产品