CNTF Receptor alpha (CNTFR) (NM_147164) Human Mass Spec Standard
CAT#: PH300487
CNTFR MS Standard C13 and N15-labeled recombinant protein (NP_671693)
View other "CNTF Receptor alpha" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CNTFR MS Standard C13 and N15-labeled recombinant protein (NP_671693) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200487 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC200487 protein sequence
Red=Cloning site Green=Tags(s) MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNT FNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENV VARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPF LVSVPITLALAAAAATASSLLI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_671693 |
RefSeq Size | 2070 |
RefSeq ORF | 1116 |
Locus ID | 1271 |
Cytogenetics | 9p13.3 |
Summary | This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and gene expression. Binding of ciliary neurotrophic factor to the encoded protein recruits the transmembrane components of the receptor, gp130 and leukemia inhibitory factor receptor, facilitating signal transduction. Single nucleotide polymorphisms in this gene may be associated with variations in muscle strength, as well as early onset of eating disorders. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403449 | CNTFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419721 | CNTFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403449 | Transient overexpression lysate of ciliary neurotrophic factor receptor (CNTFR), transcript variant 1 |
CNY 3,080.00 |
|
LY419721 | Transient overexpression lysate of ciliary neurotrophic factor receptor (CNTFR), transcript variant 2 |
CNY 3,080.00 |
|
TP300487 | Recombinant protein of human ciliary neurotrophic factor receptor (CNTFR), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它CNTF Receptor alpha产品