SNRPF (NM_003095) Human Mass Spec Standard
CAT#: PH300416
SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086)
View other "SNRPF" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200416 |
Predicted MW | 9.7 kDa |
Protein Sequence |
>RC200416 protein sequence
Red=Cloning site Green=Tags(s) MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003086 |
RefSeq Size | 806 |
RefSeq ORF | 258 |
Synonyms | Sm-F; SMF; snRNP-F |
Locus ID | 6636 |
Cytogenetics | 12q23.1 |
Summary | Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:23333303, PubMed:25555158, PubMed:26912367, PubMed:28502770, PubMed:28781166, PubMed:28076346). Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes (PubMed:11991638, PubMed:28502770, PubMed:28781166, PubMed:28076346). Is also a component of the minor U12 spliceosome (PubMed:15146077). As part of the U7 snRNP it is involved in histone 3'-end processing (PubMed:12975319).[UniProtKB/Swiss-Prot Function] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418906 | SNRPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418906 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide F (SNRPF) |
CNY 3,080.00 |
|
TP300416 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide F (SNRPF), 20 µg |
CNY 2,900.00 |