Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Mass Spec Standard
CAT#: PH300374
COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365)
View other "Cytochrome C Oxidase subunit VIc" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | COX6C MS Standard C13 and N15-labeled recombinant protein (NP_004365) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200374 |
Predicted MW | 8.8 kDa |
Protein Sequence |
>RC200374 protein sequence
Red=Cloning site Green=Tags(s) MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI FQSVK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004365 |
RefSeq Size | 921 |
RefSeq ORF | 225 |
Locus ID | 1345 |
Cytogenetics | 8q22.2 |
Summary | Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. [provided by RefSeq, Jul 2010] |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418028 | COX6C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418028 | Transient overexpression lysate of cytochrome c oxidase subunit VIc (COX6C) |
CNY 3,080.00 |
|
TP300374 | Recombinant protein of human cytochrome c oxidase subunit VIc (COX6C), 20 µg |
CNY 2,900.00 |
其它Cytochrome C Oxidase subunit VIc产品