TXNL4A (NM_006701) Human Mass Spec Standard
CAT#: PH300266
TXNL4A MS Standard C13 and N15-labeled recombinant protein (NP_006692)
View other "TXNL4A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TXNL4A MS Standard C13 and N15-labeled recombinant protein (NP_006692) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200266 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC200266 protein sequence
Red=Cloning site Green=Tags(s) MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFN KMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY RY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006692 |
RefSeq Size | 1415 |
RefSeq ORF | 426 |
Synonyms | BMKS; DIB1; DIM1; SNRNP15; TXNL4; U5-15kD |
Locus ID | 10907 |
Cytogenetics | 18q23 |
Summary | The protein encoded by this gene is a member of the U5 small ribonucleoprotein particle (snRNP), and is involved in pre-mRNA splicing. This protein contains a thioredoxin-like fold and it is expected to interact with multiple proteins. Protein-protein interactions have been observed with the polyglutamine tract-binding protein 1 (PQBP1). Mutations in both the coding region and promoter region of this gene have been associated with Burn-McKeown syndrome, which is a rare disorder characterized by craniofacial dysmorphisms, cardiac defects, hearing loss, and bilateral choanal atresia. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416472 | TXNL4A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416472 | Transient overexpression lysate of thioredoxin-like 4A (TXNL4A) |
CNY 3,080.00 |
|
TP300266 | Recombinant protein of human thioredoxin-like 4A (TXNL4A), 20 µg |
CNY 2,900.00 |