COPS6 (NM_006833) Human Mass Spec Standard
CAT#: PH300252
COPS6 MS Standard C13 and N15-labeled recombinant protein (NP_006824)
View other "COPS6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | COPS6 MS Standard C13 and N15-labeled recombinant protein (NP_006824) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200252 |
Predicted MW | 36.2 kDa |
Protein Sequence |
>RC200252 protein sequence
Red=Cloning site Green=Tags(s) MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIG ALIGKQEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHK QVCEIIESPLFLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATG SGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFY DQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006824 |
RefSeq Size | 1441 |
RefSeq ORF | 981 |
Synonyms | CSN6; MOV34-34KD |
Locus ID | 10980 |
Cytogenetics | 7q22.1 |
Summary | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416378 | COPS6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416378 | Transient overexpression lysate of COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis) (COPS6) |
CNY 3,080.00 |
|
TP300252 | Recombinant protein of human COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis) (COPS6), 20 µg |
CNY 2,900.00 |