SLC25A20 (NM_000387) Human Mass Spec Standard
CAT#: PH300234
SLC25A20 MS Standard C13 and N15-labeled recombinant protein (NP_000378)
View other "SLC25A20" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SLC25A20 MS Standard C13 and N15-labeled recombinant protein (NP_000378) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200234 |
Predicted MW | 32.9 kDa |
Protein Sequence |
>RC200234 protein sequence
Red=Cloning site Green=Tags(s) MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITG LYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQI QASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAP RILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPAN AACFLGFEVAMKFLNWATPNL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000378 |
RefSeq Size | 1909 |
RefSeq ORF | 903 |
Synonyms | CAC; CACT |
Locus ID | 788 |
Cytogenetics | 3p21.31 |
Summary | This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424755 | SLC25A20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424755 | Transient overexpression lysate of solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP300234 | Recombinant protein of human solute carrier family 25 (carnitine/acylcarnitine translocase), member 20 (SLC25A20), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
其它SLC25A20产品