ADI1 (NM_018269) Human Mass Spec Standard
CAT#: PH300115
ADI1 MS Standard C13 and N15-labeled recombinant protein (NP_060739)
View other "ADI1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ADI1 MS Standard C13 and N15-labeled recombinant protein (NP_060739) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200115 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC200115 protein sequence
Red=Cloning site Green=Tags(s) MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060739 |
RefSeq Size | 1685 |
RefSeq ORF | 537 |
Synonyms | APL1; ARD; Fe-ARD; HMFT1638; MTCBP1; mtnD; Ni-ARD; SIPL |
Locus ID | 55256 |
Cytogenetics | 2p25.3 |
Summary | This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402662 | ADI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402662 | Transient overexpression lysate of acireductone dioxygenase 1 (ADI1) |
CNY 3,080.00 |
|
TP300115 | Recombinant protein of human acireductone dioxygenase 1 (ADI1), 20 µg |
CNY 2,900.00 |