HSPC152 (TRMT112) (NM_016404) Human Mass Spec Standard
CAT#: PH300036
TRMT112 MS Standard C13 and N15-labeled recombinant protein (NP_057488)
View other "HSPC152" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TRMT112 MS Standard C13 and N15-labeled recombinant protein (NP_057488) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200036 |
Predicted MW | 14.2 kDa |
Protein Sequence |
>RC200036 protein sequence
Red=Cloning site Green=Tags(s) MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057488 |
RefSeq Size | 1305 |
RefSeq ORF | 375 |
Synonyms | HSPC152; HSPC170; hTrm112; TRM112; TRMT11-2 |
Locus ID | 51504 |
Cytogenetics | 11q13.1 |
Summary | Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed:25851604). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414001 | TRMT112 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414001 | Transient overexpression lysate of tRNA methyltransferase 11-2 homolog (S. cerevisiae) (TRMT112) |
CNY 3,080.00 |
|
TP300036 | Recombinant protein of human hypothetical protein HSPC152 (HSPC152), 20 µg |
CNY 2,900.00 |
其它HSPC152产品