nonstructural protein NS2B (NC_001474) Virus Tagged ORF Clone
CAT#: VC102548
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2B [Dengue virus 2], codon optimized for human cell expression, NP_739586
View other clones from "Virus" (13)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DENV_gp1, Dengue, DENV |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102548 represents NCBI reference of NP_739586 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCATGGCCCCTGAACGAAGCAATCATGGCAGTGGGCATGGTTTCTATTCTCGCCTCCAGCCTTTTGA AAAACGACATCCCCATGACCGGCCCCCTGGTAGCCGGAGGACTTCTGACAGTTTGCTACGTACTGACTGG TCGATCCGCAGACCTTGAACTTGAACGCGCCGCAGATGTGAAGTGGGAAGATCAGGCTGAAATTTCTGGC AGTTCCCCAATCTTGAGTATTACAATCAGCGAAGACGGATCTATGAGCATTAAAAACGAGGAAGAAGAAC AGACTTTGACTATATTGATTAGAACAGGGCTTTTGGTAATTTCAGGTCTCTTTCCAGTTTCTATCCCAAT AACCGCCGCAGCTTGGTATCTCTGGGAGGTTAAAAAACAAAGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102548 representing NP_739586
Red=Cloning sites Green=Tags MSWPLNEAIMAVGMVSILASSLLKNDIPMTGPLVAGGLLTVCYVLTGRSADLELERAADVKWEDQAEISG SSPILSITISEDGSMSIKNEEEEQTLTILIRTGLLVISGLFPVSIPITAAAWYLWEVKKQR myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001474 |
ORF Size | 393 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NC_001474.2, NP_739586 |
RefSeq ORF | 393 bp |
MW | 14.2 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102541 | Myc-DDK-tagged ORF clone of viral ORF for anchored capsid protein C [Dengue virus 2], codon optimized for human cell expression, NP_739581 |
CNY 3,800.00 |
|
VC102542 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein C [Dengue virus 2], codon optimized for human cell expression, NP_739591 |
CNY 3,800.00 |
|
VC102543 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein precursor M [Dengue virus 2], codon optimized for human cell expression, NP_739582 |
CNY 2,640.00 |
|
VC102544 | Myc-DDK-tagged ORF clone of viral ORF for membrane glycoprotein M [Dengue virus 2], codon optimized for human cell expression, NP_739592 |
CNY 3,800.00 |
|
VC102545 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein E [Dengue virus 2], codon optimized for human cell expression, NP_739583 |
CNY 3,656.00 |
|
VC102546 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS1 [Dengue virus 2], codon optimized for human cell expression, NP_739584 |
CNY 4,180.00 |
|
VC102547 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS2A [Dengue virus 2], codon optimized for human cell expression, NP_739585 |
CNY 3,800.00 |
|
VC102549 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS3 [Dengue virus 2], codon optimized for human cell expression, NP_739587 |
CNY 7,320.00 |
|
VC102550 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4A [Dengue virus 2], codon optimized for human cell expression, NP_739588 |
CNY 3,800.00 |
|
VC102551 | Myc-DDK-tagged ORF clone of viral ORF for nonstructural protein NS4B [Dengue virus 2], codon optimized for human cell expression, NP_739589 |
CNY 3,800.00 |
|
VC102552 | Myc-DDK-tagged ORF clone of viral ORF for RNA-dependent RNA polymerase NS5 [Dengue virus 2], codon optimized for human cell expression, NP_739590 |
CNY 13,210.00 |
|
VC102553 | Myc-DDK-tagged ORF clone of viral ORF for propein pr [Dengue virus 2], codon optimized for human cell expression, YP_009164954 |
CNY 3,800.00 |
|
VC102554 | Myc-DDK-tagged ORF clone of viral ORF for protein 2K [Dengue virus 2], codon optimized for human cell expression, NP_739593 |
CNY 3,800.00 |
其它nonstructural protein NS2B产品