United States
Germany
Japan
United Kingdom
China
leader peptide (NC_010810) Virus Tagged ORF Clone
CAT＃: VC102166
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for leader peptide [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950221
View other clones from "Virus" (10)
Need custom modification / cloning service?
Get a free quote
CNY 3,800.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Type | Virus Tagged ORF Clone |
| Tag | Myc-DDK |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>The Viral ORF clone VC102166 represents NCBI reference of YP_001950221 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGGCCTGCAAGCACGGGTACCCACTGATGTGCCCACTTTGTACTGCACTGGATAAAACGAGTGATG GACTGTTCACTCTGCTGTTTGATAATGAGTGGTATCCCACTGATCTCCTGACTGTGGACCTGGAGGACGA GGTATTTTACCCAGATGACCCCCACATGGAATGGACTGACCTGCCTCTCATCCAGGACATTGAGATGGAA CCCCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102166 representing YP_001950221
Red=Cloning sites Green=Tags MMACKHGYPLMCPLCTALDKTSDGLFTLLFDNEWYPTDLLTVDLEDEVFYPDDPHMEWTDLPLIQDIEME PQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | NC_010810 |
| ORF Size | 216 bp |
| OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NC_010810.1, YP_001950221 |
| RefSeq ORF | 216 bp |
| MW | 8.4 kDa |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| VC102167 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP4 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950222 |
CNY 3,800.00 |
|
| VC102168 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP2 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950223 |
CNY 3,800.00 |
|
| VC102169 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP3 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950224 |
CNY 3,800.00 |
|
| VC102170 | Myc-DDK-tagged ORF clone of viral ORF for capsid protein VP1 [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950225 |
CNY 3,800.00 |
|
| VC102171 | Myc-DDK-tagged ORF clone of viral ORF for protein 2A [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950226 |
CNY 3,800.00 |
|
| VC102172 | Myc-DDK-tagged ORF clone of viral ORF for protein 2B [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950227 |
CNY 3,800.00 |
|
| VC102173 | Myc-DDK-tagged ORF clone of viral ORF for protein 2C [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950228 |
CNY 3,800.00 |
|
| VC102174 | Myc-DDK-tagged ORF clone of viral ORF for protein 3A [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950229 |
CNY 3,800.00 |
|
| VC102175 | Myc-DDK-tagged ORF clone of viral ORF for protein 3B [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950230 |
CNY 3,800.00 |
|
| VC102176 | Myc-DDK-tagged ORF clone of viral ORF for protein 3C [Human TMEV-like cardiovirus], codon optimized for human cell expression, YP_001950231 |
CNY 3,800.00 |
其它leader peptide产品
