Emp2 (NM_001007721) Rat Tagged ORF Clone
CAT#: RR215211
- TrueORF®
Emp2 (Myc-DDK-tagged ORF) - Rat epithelial membrane protein 2 (Emp2), (10 ug)
"NM_001007721" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 300.00
Specifications
Product Data | |
Type | Rat Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | EMP-2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RR215211 representing NM_001007721
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTGGTGATTCTTGCCTTCATCATCGTCTTCCACATCGTGTCTACGGCACTCTTGTTCATTTCAACCA TTGACAATGCCTGGTGGGTAGGAGATGGCTTCTCAGCTGACATCTGGAGAGTGTGCACCAACAGCACAAA CTGTACAGAGATCAATGACCTGAGCAGTACCGAGGAGTTTTCAGGTTACTCTGTGATGCAGGCGGTGCAG GCCACCATGATCCTCTCCACCATCCTCTCCTGCATCTCCTTCCTCATCTTTCTGCTCCAGCTCTTCCGCC TCAAGCAGGGAGAGAGGTTCGTCCTGACGGCCATCATCCAGCTCATGTCCTGTCTGTGTGTCATGATCGG GGCTTCCGTCTATACAGACCGGCGGCAAGACCTTCACCATCAGAACAGCCAGCTCTATTACCTACTGCAA GAAGGCAGCTACGGTTACTCCTTCATCCTGGCCTGGGTGGCTTTCGCCTTCACTTTCATCAGCGGCCTCA TGTACATGATCCTGAGGAAGCGCAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RR215211 representing NM_001007721
Red=Cloning site Green=Tags(s) MLVILAFIIVFHIVSTALLFISTIDNAWWVGDGFSADIWRVCTNSTNCTEINDLSSTEEFSGYSVMQAVQ ATMILSTILSCISFLIFLLQLFRLKQGERFVLTAIIQLMSCLCVMIGASVYTDRRQDLHHQNSQLYYLLQ EGSYGYSFILAWVAFAFTFISGLMYMILRKRK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001007721 |
ORF Size | 516 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001007721.1, NP_001007722.1 |
RefSeq Size | 3154 bp |
RefSeq ORF | 519 bp |
Locus ID | 360468 |
UniProt ID | Q66HH2 |
MW | 19.6 kDa |
Gene Summary | Functions as a key regulator of cell membrane composition by regulating proteins surface expression. Also, plays a role in regulation of processes including cell migration, cell proliferation, cell contraction and cell adhesion. Negatively regulates caveolae formation by reducing CAV1 expression and CAV1 amount by increasing lysosomal degradation. Facilitates surface trafficking and the formation of lipid rafts bearing GPI-anchor proteins. Regulates surface expression of MHC1 and ICAM1 proteins increasing susceptibility to T-cell mediated cytotoxicity. Regulates the plasma membrane expression of the integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3 and ITGA5-ITGB1 resulting in modulation of cell-matrix adhesion. Also regulates many processes through PTK2. Regulates blood vessel endothelial cell migration and angiogenesis by regulating VEGF protein expression through PTK2 activation. Regulates cell migration and cell contraction through PTK2 and SRC activation. Regulates focal adhesion density, F-actin conformation and cell adhesion capacity through interaction with PTK2. Positively regulates cell proliferation. Plays a role during cell death and cell blebbing. Promotes angiogenesis and vasculogenesis through induction of VEGFA via a HIF1A-dependent pathway. Also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3. May play a role in glomerular filtration.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RN215211 | Emp2 (untagged ORF) - Rat epithelial membrane protein 2 (Emp2), (10 ug) |
CNY 3,990.00 |
|
RR215211L3 | Lenti ORF clone of Emp2 (Myc-DDK-tagged ORF) - Rat epithelial membrane protein 2 (Emp2), (10 ug) |
CNY 6,080.00 |
|
RR215211L4 | Lenti ORF clone of Emp2 (mGFP-tagged ORF) - Rat epithelial membrane protein 2 (Emp2), (10 ug) |
CNY 6,650.00 |