Ost4 (NM_001134690) Rat Tagged ORF Clone
CAT#: RR200006
- TrueORF®
LOC100188932 (Myc-DDK-tagged ORF) - Rat dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (LOC100188932), transcript variant 2, (10 ug)
"NM_001134690" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Rat Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | Ost4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RR200006 representing NM_001134690
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGGTCC TCTATCACTACGTGGCAGTAAATAACCCCAAGAAGCAGGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RR200006 representing NM_001134690
Red=Cloning site Green=Tags(s) MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001134690 |
ORF Size | 111 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001134690.1, NP_001128162.1 |
RefSeq Size | 570 bp |
RefSeq ORF | 114 bp |
Locus ID | 100188932 |
UniProt ID | B0BLS0 |
MW | 4.2 kDa |
Gene Summary | Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. Specifically involved in maintaining stability of STT3A-containing OST complexes.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RN200006 | LOC100188932 (untagged ORF) - Rat dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (LOC100188932), transcript variant 2, (10 ug) |
CNY 3,990.00 |
|
RR200006L3 | Lenti ORF clone of LOC100188932 (Myc-DDK-tagged ORF) - Rat dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (LOC100188932), transcript variant 2, (10 ug) |
CNY 6,080.00 |
|
RR200006L4 | Lenti ORF clone of LOC100188932 (mGFP-tagged ORF) - Rat dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 (LOC100188932), transcript variant 2, (10 ug) |
CNY 6,650.00 |