ZNF195 (NM_001256823) Human Tagged ORF Clone

CAT#: RG231603

  • TrueORF®

ZNF195 (tGFP-tagged) - Homo sapiens zinc finger protein 195 (ZNF195), transcript variant 8

ORF Plasmid: DDK tGFP



  "NM_001256823" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-ZNF195 Antibody
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms HRF1; ZNFP104
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG231603 representing NM_001256823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGTGCTCAGACTCTGTTGACGTTCAGGGATGTGGCCATAGAATTCTCCCTGGAGGAGTGGAAAT
GCCTGGACCTCGCTCAGCAGAATTTGTACAGGGATGTGATGTTGGAGAACTACAGAAACTTGTTCTCCGT
TGGTCTCACTGTCTGTAAGCCAGGCCTGATCACCTGCCTGGAGCAACGAAAAGAGCCCTGGAATGTGAAG
AGACAGGAGGCAGCAGACGGACATCCAGGTATTTTCTTTGTGGTTACCATGGAAATTATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG231603 representing NM_001256823
Red=Cloning site Green=Tags(s)

MAGAQTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVK
RQEAADGHPGIFFVVTMEII

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256823
ORF Size 270 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001256823.2
RefSeq Size 3203 bp
RefSeq ORF 273 bp
Locus ID 7748
UniProt ID O14628
Protein Families Transcription Factors
Gene Summary This gene encodes a protein belonging to the Krueppel C2H2-type zinc-finger protein family. These family members are transcription factors that are implicated in a variety of cellular processes. This gene is located near the centromeric border of chromosome 11p15.5, next to an imprinted domain that is associated with maternal-specific loss of heterozygosity in Wilms' tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...