United States
Germany
Japan
United Kingdom
China
HMGA2 (NM_003483) Human Tagged ORF Clone
CAT＃: RG214629
- TrueORF®
HMGA2 (tGFP-tagged) - Human high mobility group AT-hook 2 (HMGA2), transcript variant 1
ORF Plasmid: DDK
"NM_003483" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,800.00
CNY 4,370.00
| Cited in 4 publications. |
Product images
CNY 1,000.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | TurboGFP |
| Synonyms | BABL; HMGI-C; HMGIC; LIPO; SRS5; STQTL9 |
| Vector | pCMV6-AC-GFP |
| E. coli Selection | Ampicillin (100 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RG214629 representing NM_003483
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCGCACGCGGTGAGGGCGCGGGGCAGCCGTCCACTTCAGCCCAGGGACAACCTGCCGCCCCAGCGC CTCAGAAGAGAGGACGCGGCCGCCCCAGGAAGCAGCAGCAAGAACCAACCGGTGAGCCCTCTCCTAAGAG ACCCAGGGGAAGACCCAAAGGCAGCAAAAACAAGAGTCCCTCTAAAGCAGCTCAAAAGAAAGCAGAAGCC ACTGGAGAAAAACGGCCAAGAGGCAGACCTAGGAAATGGCCACAACAAGTTGTTCAGAAGAAGCCTGCTC AGGAGGAAACTGAAGAGACATCCTCACAAGAGTCTGCCGAAGAGGAC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG214629 representing NM_003483
Red=Cloning site Green=Tags(s) MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEA TGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED TRTRPLE - GFP Tag - V |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_003483 |
| ORF Size | 327 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_003483.6 |
| RefSeq Size | 4150 bp |
| RefSeq ORF | 330 bp |
| Locus ID | 8091 |
| UniProt ID | P52926 |
| Protein Families | Druggable Genome |
| Gene Summary | This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Citations (4)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Multiple myeloma driving factor WHSC1 is a transcription target of oncogene HMGA2 that facilitates colon cancer proliferation and metastasis
,Liu, HH;Lee, CH;Hsieh, YC;Hsu, DW;Cho, EC;,
Biochemical and biophysical research communications
,PubMed ID 34166916
[HMGA2]
|
|
Dicoumarol suppresses HMGA2-mediated oncogenic capacities and inhibits cell proliferation by inducing apoptosis in colon cancer
,Chen, CH;Hsieh, YC;Yang, PM;Liu, YR;Cho, EC;,
Biochem. Biophys. Res. Commun.
,PubMed ID 32063361
[HMGA2]
|
|
An Integrated Bioinformatics Analysis Repurposes an Antihelminthic Drug Niclosamide for Treating HMGA2-Overexpressing Human Colorectal Cancer
,Leung, SW;Chou, CJ;Huang, TC;Yang, PM;,
Cancers (Basel) 2019
,PubMed ID 31581665
[HMGA2]
|
|
HMGA2 Is a Driver of Tumor Metastasis
,Asahiro Morishita, M. Raza Zaidi, Akira Mitoro, Devipriya Sankarasharma, Matthias Szabolcs, Yasunori Okada, Jeanine D'Armiento, and Kiran Chada,
Cancer Res., Jul 2013; 73: 4289 - 4299.
,PubMed ID 23722545
[HMGA2]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC214629 | HMGA2 (Myc-DDK-tagged)-Human high mobility group AT-hook 2 (HMGA2), transcript variant 1 |
CNY 1,200.00 |
|
| RC214629L1 | Lenti ORF clone of Human high mobility group AT-hook 2 (HMGA2), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
| RC214629L2 | Lenti ORF clone of Human high mobility group AT-hook 2 (HMGA2), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
| RC214629L3 | Lenti ORF clone of Human high mobility group AT-hook 2 (HMGA2), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC214629L4 | Lenti ORF clone of Human high mobility group AT-hook 2 (HMGA2), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
| SC303313 | HMGA2 (untagged)-Human high mobility group AT-hook 2 (HMGA2), transcript variant 1 |
CNY 1,200.00 |
