IRX5 (NM_005853) Human Tagged ORF Clone
CAT#: RG212385
- TrueORF®
IRX5 (tGFP-tagged) - Human iroquois homeobox 5 (IRX5)
ORF Plasmid: DDK
"NM_005853" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 4,750.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | HMMS; IRX-2a; IRXB2 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG212385 representing NM_005853
Red=Cloning site Green=Tags(s) MSYPQGYLYQPSASLALYSCPAYSTSVISGPRTDELGRSSSGSAFSPYAGSTAFTAPSPGYNSHLQYGAD PAAAAAAAFSSYVGSPYDHTPGMAGSLGYHPYAAPLGSYPYGDPAYRKNATRDATATLKAWLNEHRKNPY PTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWTPRNRSEDEEEEENIDLEKNDEDEPQKPEDK ADPEGPEAGGAEQKAASGCERLQGPPTPAGKETEGSLSDSDFKEPPSEGRLDALQGPPRTGGPSPAGPAA ARLAEDPAPHYPAGAPAPGPHPAAGEVPPGPGGPSVIHSPPPPPPPAVLAKPKLWSLAEIATSSDKVKDG GGGNEGSPCPPCPGPIAGQALGGSRASPAPAPSRSPSAQCPFPGGTVLSRPLYYTAPFYPGYTNYGSFGH LHGHPGPGPGPTTGPGSHFNGLNQTVLNRADALAKDPKMLRSQSQLDLCKDSPYELKKGMSDI TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005853 |
ORF Size | 1449 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005853.4, NP_005844.3 |
RefSeq Size | 2078 bp |
RefSeq ORF | 1452 bp |
Locus ID | 10265 |
UniProt ID | P78411 |
Protein Families | Transcription Factors |
Gene Summary | This gene encodes a member of the iroquois homeobox gene family, which are involved in several embryonic developmental processes. Knockout mice lacking this gene show that it is required for retinal cone bipolar cell differentiation, and that it negatively regulates potassium channel gene expression in the heart to ensure coordinated cardiac repolarization. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC212385 | IRX5 (Myc-DDK-tagged)-Human iroquois homeobox 5 (IRX5) |
CNY 3,656.00 |
|
RC212385L3 | Lenti-ORF clone of IRX5 (Myc-DDK-tagged)-Human iroquois homeobox 5 (IRX5) |
CNY 6,180.00 |
|
RC212385L4 | Lenti-ORF clone of IRX5 (mGFP-tagged)-Human iroquois homeobox 5 (IRX5) |
CNY 6,180.00 |
|
SC128090 | IRX5 (untagged)-Human iroquois homeobox 5 (IRX5) |
CNY 3,656.00 |