C15orf15 (RSL24D1) (NM_016304) Human Tagged ORF Clone

CAT#: RG203261

  • TrueORF®

RSL24D1 (tGFP-tagged) - Human ribosomal L24 domain containing 1 (RSL24D1)

ORF Plasmid: DDK tGFP



  "NM_016304" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,800.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Rabbit Polyclonal Anti-C15orf15 Antibody - middle region
    • 50 ug

CNY 5,250.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms C15orf15; HRP-L30-iso; L30; RLP24; RPL24; RPL24L; TVAS3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203261 representing NM_016304
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGTATCGAAAAGTGTTATTTCTGTTCGGGGCCCATCTATCCTGGACACGGCATGATGTTCGTCCGCA
ACGATTGCAAGGTGTTCAGATTTTGCAAATCTAAATGTCATAAAAACTTTAAAAAGAAGCGCAATCCTCG
CAAAGTTAGGTGGACCAAAGCATTCCGGAAAGCAGCTGGTAAAGAGCTTACAGTGGATAATTCATTTGAA
TTTGAAAAACGTAGAAATGAACCTATCAAATACCAGCGAGAGCTATGGAATAAAACTATTGATGCGATGA
AGAGAGTTGAAGAAATCAAACAGAAGCGCCAAGCTAAATTTATAATGAACAGATTGAAGAAAAATAAAGA
GCTACAGAAAGTTCAGGATATCAAAGAAGTCAAGCAAAACATCCATCTTATCCGAGCCCCTCTTGCAGGC
AAAGGGAAACAGTTGGAAGAGAAAATGGTACAGCAGTTACAAGAGGATGTGGACATGGAAGATGCTCCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203261 representing NM_016304
Red=Cloning site Green=Tags(s)

MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFE
FEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAG
KGKQLEEKMVQQLQEDVDMEDAP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016304
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016304.3
RefSeq Size 1487 bp
RefSeq ORF 492 bp
Locus ID 51187
UniProt ID Q9UHA3
Domains Ribosomal_L24e
Protein Pathways Ribosome
Gene Summary This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...