MRPS7 (NM_015971) Human Tagged ORF Clone

CAT#: RG200031

  • TrueORF®

MRPS7 (tGFP-tagged) - Human mitochondrial ribosomal protein S7 (MRPS7), nuclear gene encoding mitochondrial protein

ORF Plasmid: DDK tGFP



  "NM_015971" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 4,000.00

CNY 4,370.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


MRPS7 mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms bMRP27a; COXPD34; MRP-S; MRP-S7; RP-S7; RPMS7; S7mt
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200031 representing NM_015971
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTGCCCCCGCAGTGAAGGTTGCCCGAGGATGGTCGGGCCTGGCGTTGGGCGTGCGGCGGGCTGTCT
TGCAGCTTCCAGGGCTAACTCAGGTGAGATGGAGCCGCTATAGTCCTGAATTCAAGGATCCCTTGATTGA
CAAGGAATATTATCGCAAGCCAGTGGAGGAGCTAACTGAGGAGGAGAAATATGTTCGGGAGCTCAAGAAG
ACTCAGCTCATCAAAGCTGCTCCAGCAGGGAAAACAAGTTCTGTGTTTGAAGACCCAGTCATCAGTAAAT
TCACCAACATGATGATGATAGGAGGAAACAAAGTACTGGCCAGATCCCTCATGATTCAGACTCTGGAAGC
TGTGAAAAGGAAGCAGTTTGAGAAGTACCATGCCGCTTCTGCAGAGGAACAGGCAACCATCGAACGCAAC
CCCTACACCATCTTCCATCAAGCACTGAAAAACTGTGAGCCTATGATTGGGCTGGTACCCATCCTCAAGG
GAGGCCGTTTCTACCAGGTCCCTGTACCCCTACCCGACCGGCGTCGCCGCTTCCTAGCCATGAAGTGGAT
GATCACTGAGTGCCGGGATAAAAAGCACCAGCGGACACTGATGCCGGAGAAGCTGTCACACAAGCTGCTG
GAGGCTTTCCATAACCAGGGCCCCGTGATCAAGAGGAAGCATGACTTGCACAAGATGGCAGAGGCCAACC
GTGCCCTGGCCCACTACCGCTGGTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200031 representing NM_015971
Red=Cloning site Green=Tags(s)

MVAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYVRELKK
TQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN
PYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKHQRTLMPEKLSHKLL
EAFHNQGPVIKRKHDLHKMAEANRALAHYRWW

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015971
ORF Size 726 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_015971.2, NP_057055.1
RefSeq Size 1393 bp
RefSeq ORF 729 bp
Locus ID 51081
UniProt ID Q9Y2R9
Domains Ribosomal_S7
Gene Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...