ELOVL7 (NM_001297618) Human Tagged ORF Clone

CAT#: RC236470

  • TrueORF®

ELOVL7 (myc-DDK-tagged) - Human ELOVL fatty acid elongase 7 (ELOVL7), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001297618" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal ELOVL7 Antibody
    • 100 ug

CNY 5,808.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236470 representing NM_001297618
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGCTGGGGTATAGGTTATTCATTTCGATGTGACATTGTTGACTATTCACGGTCACCCACAGCTT
TGAGGATGGCACGTACCTGCTGGCTTTATTACTTCTCCAAATTTATTGAGCTATTAGATACGATCTTTTT
TGTTCTGCGCAAGAAAAATAGCCAAGTGACTTTCCTTCATGTATTCCATCATACCATCATGCCGTGGACC
TGGTGGTTTGGAGTCAAATTTGCTGCAGGTGGTTTGGGAACATTCCATGCCCTTCTAAATACAGCTGTAC
ATGTAGTCATGTATTCCTACTATGGACTTTCTGCATTGGGGCCAGCCTACCAGAAGTATTTGTGGTGGAA
AAAATATTTGACATCATTACAGCTTGTCCAGTTTGTTATTGTCGCCATCCACATAAGCCAGTTCTTTTTC
ATGGAGGATTGCAAGTATCAGTTTCCAGTCTTTGCGTGCATCATTATGAGTTACAGTTTCATGTTTCTGC
TGCTCTTTCTCCATTTTTGGTACCGTGCTTACACCAAAGGTCAGAGGTTGCCCAAAACTGTGAAAAATGG
AACTTGCAAAAACAAAGATAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236470 representing NM_001297618
Red=Cloning site Green=Tags(s)

MSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWT
WWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFF
MEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001297618
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001297618.2
RefSeq Size 3856 bp
RefSeq ORF 585 bp
Locus ID 79993
UniProt ID A1L3X0
Protein Families Transmembrane
MW 23.5 kDa
Gene Summary Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme with higher activity toward C18 acyl-CoAs, especially C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. Also active toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and weakly toward C20:0-CoA. Little or no activity toward C22:0-, C24:0-, or C26:0-CoAs. May participate in the production of saturated and polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...