PEX19 (NM_001193644) Human Tagged ORF Clone

CAT#: RC231120

  • TrueORF®

PEX19 (Myc-DDK-tagged)-Human peroxisomal biogenesis factor 19 (PEX19), transcript variant 4

ORF Plasmid: DDK tGFP



  "NM_001193644" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal antibody to PEX19 (peroxisomal biogenesis factor 19)
    • 100 ul

CNY 6,281.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms D1S2223E; HK33; PBD12A; PMP1; PMPI; PXF; PXMP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231120 representing NM_001193644
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCCGCTGAGGAAGGCTGTAGTGTCGGGGCCGAAGCGGACAGGGAATTGGAGGAGCTTCTGGAAA
GTGCTCTTGATGATTTCGATAAAGCCAAACCCTCCCCAGCACCCCCTTCTACCACCACGGCCCCTGATGC
TTCGGGGCCCCAGAAGAGATCGCCAGGAGACACTGCCAAAGATGCCCTCTTCGCTTCCCAAGAGAAGTTT
TTCCAGGAACTATTCGACAGTGAACTGGCTTCCCAAGCCACTGCGGAGTTCGAGAAGGCAATGAAGGAGT
TGGCTGAGGAAGAACCCCACCTGGTGGAGCAGTTCCAAAAGCTCTCAGAGGCTGCAGGGAGAGTGGGCAG
TGATATGACCTCCCAACAAGAATTCACTTCTTGCCTAAAGGAAACACTAAGTGGATTAGCCAAAAATGCC
ACTGACCTTCAGAACTCCAGCATGTCGGAAGAAGAGCTGACCAAGGCCATGGAGGGGCTAGGCATGGACG
AAGGGGATGGGGAAGGGAACATCCTCCCCATCATGCAGAGTATTATGCAGAACCTACTCTCCAAGGATGT
GCTGTACCCATCACTGAAGGAGATCACAGAAAAGTATCCAGAATGGTTGCAGAGTCATCGGGAATCTCTA
CCTCCAGAGCAGTTTGAAAAATATCAGGAGCAGCACAGCGTCATGTGCAAAATATGTGAGCAGTTTGAGG
CAGAGACCCCCACAGACAGTGAAACCACTCAAAAGGCTCGTTTTGAGATGGTGCTGGATCTTATGCAGCA
GCTACAAGATTTAGGCCATCCTCCAAAAGAGCTGGCTGGAGAGATGGTGCCAGTGGTGAACAGTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231120 representing NM_001193644
Red=Cloning site Green=Tags(s)

MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKF
FQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNA
TDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESL
PPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMVPVVNSV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001193644
ORF Size 837 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001193644.1, NP_001180573.1
RefSeq ORF 840 bp
Locus ID 5824
UniProt ID P40855
Protein Families Druggable Genome
MW 31.2 kDa
Gene Summary This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. These disorders have at least 14 complementation groups, with more than one phenotype being observed for some complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14), which is also known as PBD-CGJ. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...