PTP4A2 (NM_001195100) Human Tagged ORF Clone

CAT#: RC230983

  • TrueORF®

PTP4A2 (Myc-DDK-tagged)-Human protein tyrosine phosphatase type IVA, member 2 (PTP4A2), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001195100" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Anti-PTP4A2 rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms HH7-2; HH13; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTPCAAX2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC230983 representing NM_001195100
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCGTCCAGCCCCTGTGGAGATCTCCTATGAGAACATGCGTTTTCTGATAACTCACAACCCTACCA
ATGCTACTCTCAACAAGTTCACAGAGGAACTTAAGAAGTATGGAGTGACGACTTTGGTTCGAGTTTGTGA
TGCTACATATGATAAAGCTCCAGTTGAAAAAGAAGGAATCCACGTTCTAGATTGGCCATTTGATGATGGA
GCTCCACCCCCTAATCAGATAGTAGATGATTGGTTAAACCTGTTAAAAACCAAATTTCGTGAAGAGCCAG
GTTGCTGTGTTGCAGTGCATTGTGTTGCAGGATTGGGAAGAAAAAGAAGGGGAGCGTTCAATTCCAAACA
GCTGCTTTATTTGGAGAAATACCGACCTAAGATGCGATTACGCTTCAGAGATACCAATGGGCATTGCTGT
GTTCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230983 representing NM_001195100
Red=Cloning site Green=Tags(s)

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDG
APPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCC
VQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001195100
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001195100.2
RefSeq ORF 429 bp
Locus ID 8073
UniProt ID Q12974
Protein Families Druggable Genome, Phosphatase
MW 16.8 kDa
Gene Summary The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17. [provided by RefSeq, Aug 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...