ERCC1 (NM_001166049) Human Tagged ORF Clone
CAT#: RC228204
- TrueORF®
ERCC1 (Myc-DDK-tagged)-Human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 3
ORF Plasmid: tGFP
"NM_001166049" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
Cited in 2 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | COFS4; RAD10; UV20 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC228204 representing NM_001166049
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACCCTGGGAAGGACAAAGAGGGGGTGCCCCAGCCCTCAGGGCCGCCAGCAAGGAAGAAATTTGTGA TACCCCTCGACGAGGATGAGGTCCCTCCTGGAGTGGCCAAGCCCTTATTCCGATCTACACAGAGCCTTCC CACTGTGGACACCTCGGCCCAGGCGGCCCCTCAGACCTACGCCGAATATGCCATCTCACAGCCTCTGGAA GGGGCTGGGGCCACGTGCCCCACAGGGTCAGAGCCCCTGGCAGGAGAGACGCCCAACCAGGCCCTGAAAC CCGGGGCAAAATCCAACAGCATCATTGTGAGCCCTCGGCAGAGGGGCAATCCCGTACTGAAGTTCGTGCG CAATGTGCCCTGGGAATTTGGCGACGTAATTCCCGACTATGTGCTGGGCCAGAGCACCTGTGCCCTGTTC CTCAGCCTCCGCTACCACAACCTGCACCCAGACTACATCCATGGGCGGCTGCAGAGCCTGGGGAAGAACT TCGCCTTGCGGGTCCTGCTTGTCCAGGTGGATGTGAAAGATCCCCAGCAGGCCCTCAAGGAGCTGGCTAA GATGTGTATCCTGGCCGACTGCACATTGATCCTCGCCTGGAGCCCCGAGGAAGCTGGGCGGTACCTGGAG ACCTACAAGGCCTATGAGCAGAAACCAGCGGACCTCCTGATGGAGAAGCTAGAGCAGGACTTCGTCTCCC GGTCTCTGGAACAGCTCATCGCCGCATCAAGAGAAGATCTGGCCTTATGCCCAGGCCTGGGCCCTCAGAA AGCCCGGAGGCTGTTTGATGTCCTGCACGAGCCCTTCTTGAAAGTACCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC228204 representing NM_001166049
Red=Cloning site Green=Tags(s) MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLE GAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALF LSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLE TYKAYEQKPADLLMEKLEQDFVSRSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001166049 |
ORF Size | 819 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001166049.2 |
RefSeq ORF | 822 bp |
Locus ID | 2067 |
UniProt ID | P07992 |
Protein Families | Druggable Genome |
Protein Pathways | Nucleotide excision repair |
MW | 29.8 kDa |
Gene Summary | The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand. [provided by RefSeq, Oct 2009] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
A newly established monoclonal antibody against ERCC1 detects major isoforms of ERCC1 in gastric cancer
,null,
Global Health & Medicine
,PubMed ID 34532603
[ERCC1]
|
A newly established monoclonal antibody against ERCC1 detects major isoforms of ERCC1 in gastric cancer
,Oishi, T;Sasaki, Y;Tong, Y;Chen, L;Onodera, T;Iwasa, S;Udo, E;Furusato, B;Fujimori, H;Imamichi, S;Honda, T;Bessho, T;Fukuoka, J;Ashizawa, K;Yanagihara, K;Nakao, K;Yamada, Y;Hiraoka, N;Masutani, M;,
Global Health & Medicine
[ERCC1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC228204L1 | Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 3, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC228204L2 | Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 3, mGFP tagged |
CNY 5,890.00 |
|
RC228204L3 | Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 3, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC228204L4 | Lenti ORF clone of Human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 3, mGFP tagged |
CNY 5,890.00 |
|
RG228204 | ERCC1 (tGFP-tagged) - Human excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) (ERCC1), transcript variant 3 |
CNY 4,370.00 |
|
SC326839 | ERCC1 (untagged)-Human excision repair cross-complementing rodent repair deficiency complementation group 1 (includes overlapping antisense sequence) (ERCC1) transcript variant 3 |
CNY 3,600.00 |