GSTM1 (NM_000561) Human Tagged ORF Clone
CAT#: RC223332
GSTM1 (Myc-DDK-tagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1
ORF Plasmid: tGFP
"NM_000561" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,990.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | GST1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; GTM1; H-B; MU; MU-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC223332 representing NM_000561
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCATGATACTGGGGTACTGGGACATCCGCGGGCTGGCCCACGCCATCCGCCTGCTCCTGGAATACA CAGACTCAAGCTATGAGGAAAAGAAGTACACGATGGGGGACGCTCCTGATTATGACAGAAGCCAGTGGCT GAATGAAAAATTCAAGCTGGGCCTGGACTTTCCCAATCTGCCCTACTTGATTGATGGGGCTCACAAGATC ACCCAGAGCAACGCCATCTTGTGCTACATTGCCCGCAAGCACAACCTGTGTGGGGAGACAGAAGAGGAGA AGATTCGTGTGGACATTTTGGAGAACCAGACCATGGACAACCATATGCAGCTGGGCATGATCTGCTACAA TCCAGAATTTGAGAAACTGAAGCCAAAGTACTTGGAGGAACTCCCTGAAAAGCTAAAGCTCTACTCAGAG TTTCTGGGGAAGCGGCCATGGTTTGCAGGAAACAAGATCACTTTTGTAGATTTTCTCGTCTATGATGTCC TTGACCTCCACCGTATATTTGAGCCCAAGTGCTTGGACGCCTTCCCAAATCTGAAGGACTTCATCTCCCG CTTTGAGGGCTTGGAGAAGATCTCTGCCTACATGAAGTCCAGCCGCTTCCTCCCAAGACCTGTGTTCTCA AAGATGGCTGTCTGGGGCAACAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC223332 representing NM_000561
Red=Cloning site Green=Tags(s) MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI TQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSE FLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS KMAVWGNK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_000561 |
ORF Size | 654 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000561.4 |
RefSeq Size | 1161 bp |
RefSeq ORF | 657 bp |
Locus ID | 2944 |
UniProt ID | P09488 |
Domains | GST_N, GST_C |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
MW | 25.5 kDa |
Gene Summary | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. [provided by RefSeq, Jul 2008] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Anti-Cancer Effects and Tumor Marker Role of Glutathione S -Transferase Mu 5 in Human Bladder Cancer
,null,
International Journal of Molecular Sciences
,PubMed ID 33802702
[GSTM1]
|
Role of Oxidative Stress Mediated by Glutathione-S-transferase in Thiopurines' Toxic Effects
,Pelin, M;De Iudicibus, S;Fusco, L;Taboga, E;Pellizzari, G;Lagatolla, C;Martelossi, S;Ventura, A;Decorti, G;Stocco, G;,
Chem. Res. Toxicol.
,PubMed ID 25928802
[GSTM1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC223332L1 | Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC223332L2 | Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC223332L3 | Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC223332L4 | Lenti ORF clone of Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG223332 | GSTM1 (tGFP-tagged) - Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1 |
CNY 4,000.00 |
|
SC119838 | GSTM1 (untagged)-Human glutathione S-transferase mu 1 (GSTM1), transcript variant 1 |
CNY 2,400.00 |