DLX4 (NM_001934) Human Tagged ORF Clone

CAT#: RC223036

  • TrueORF®

DLX4 (Myc-DDK-tagged)-Human distal-less homeobox 4 (DLX4), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001934" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,990.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


DLX4 mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms BP1; DLX7; DLX8; DLX9; OFC15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223036 representing NM_001934
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTGTCCGTCCTACCCCCTCGCTCCCTCCTCGCCCCCTACACCGTGTTGTGCTGCCCACCAGACT
CGGAGAAGCCGCGGCTGTCCCCGGAACCCTCCGAGCGGCGCCCTCAGGCCCCCGCCAAAAAGCTCCGCAA
GCCGAGGACCATCTACTCCAGCCTGCAGCTGCAGCACCTAAACCAGCGTTTCCAGCACACGCAGTACCTG
GCGCTGCCCGAGAGGGCCCAGCTGGCAGCGCAGCTCGGCCTCACCCAGACCCAGGTAAAGATCTGGTTTC
AGAACAAACGCTCCAAGTATAAGAAGCTCCTGAAGCAGAATTCTGGGGGGCAGGAAGGGGACTTCCCTGG
GAGGACCTTCTCTGTGTCTCCCTGCTCCCCACCCCTCCCCTCCCTCTGGGATCTACCCAAGGCAGGGACC
CTGCCCACCAGTGGCTATGGCAACAGCTTTGGAGCCTGGTATCAGCATCACTCCTCAGATGTCCTGGCTT
CGCCTCAGATGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223036 representing NM_001934
Red=Cloning site Green=Tags(s)

MKLSVLPPRSLLAPYTVLCCPPDSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYL
ALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGT
LPTSGYGNSFGAWYQHHSSDVLASPQMM

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001934
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001934.3
RefSeq Size 1405 bp
RefSeq ORF 507 bp
Locus ID 1748
UniProt ID Q92988
Domains homeobox
Protein Families Transcription Factors
MW 18.7 kDa
Gene Summary Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...