Small EDRK rich factor 1 (SERF1B) (NM_022978) Human Tagged ORF Clone
CAT#: RC221726
SERF1B (Myc-DDK-tagged)-Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2
ORF Plasmid: tGFP
"NM_022978" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | FAM2B; h4F5; H4F5C |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC221726 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCGTGGAAATCAACGAGAACTTGCCCGCCAGAAAAACATGAAGAAAACCCAGGAAATTAGCAAGG GAAAGAGGAAAGAGGATAGCTTGACTGCCTCTCAGAGAAAGCAGAGTTCTGGAGGCCAGAAATCTGAGAG CAAGATGTCAGCTGGGCCACACCTCCCTCTGAAGGCTCCAAGGGAGAATCCTTGCTTTCCTCTTCCAGCT GCTGGTGGCTCCAGGTATTACTTGGCTTATGGCAGCATAACTCCTATCTCTGCCTTTGTCTTTGTGGTCT TCTTTTCTGTCTTCTTCCCTTCTTTTTATGAGGACTTTTGCTGTTGGATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC221726 protein sequence
Red=Cloning site Green=Tags(s) MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPA AGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_022978 |
ORF Size | 330 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_022978.3 |
RefSeq Size | 1917 bp |
RefSeq ORF | 333 bp |
Locus ID | 728492 |
UniProt ID | O75920 |
Protein Families | Transmembrane |
MW | 12.3 kDa |
Gene Summary | This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is the centromeric copy which is identical to the telomeric copy. Alternatively spliced transcripts have been documented but it is unclear whether alternative splicing occurs for both the centromeric and telomeric copies of the gene. The gene encodes a protein of unknown function which bears low-level homology with the RNA-binding domain of matrin-cyclophilin, a protein which colocalizes with small nuclear ribonucleoproteins (snRNPs) and the SMN1 gene product. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC221726L1 | Lenti ORF clone of Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC221726L2 | Lenti ORF clone of Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC221726L3 | Lenti ORF clone of Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC221726L4 | Lenti ORF clone of Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG221726 | SERF1B (tGFP-tagged) - Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2 |
CNY 2,800.00 |
|
SC111358 | SERF1B (untagged)-Human small EDRK-rich factor 1B (centromeric) (SERF1B), transcript variant 2 |
CNY 1,200.00 |
其它Small EDRK rich factor 1产品