UBE2C (NM_181803) Human Tagged ORF Clone
CAT#: RC219935
- TrueORF®
UBE2C (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 6
ORF Plasmid: tGFP
"NM_181803" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | dJ447F3.2; UBCH10 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC219935 representing NM_181803
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTTCCCAAAACCGCGACCCAGCCGCCACTAGCGTCGCCGCCGCCCGTAAAGGAGCTGAGCCGAGCG GGGGCGCCGCCCGGGGTCCGGTGGGCAAAAGGCTACAGCAGGAGCTGATGACCCTCATGAACCCAACATT GATAGTCCCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC219935 representing NM_181803
Red=Cloning site Green=Tags(s) MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMNPTLIVP myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_181803 |
ORF Size | 150 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_181803.1, NP_861519.1 |
RefSeq Size | 520 bp |
RefSeq ORF | 152 bp |
Locus ID | 11065 |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
MW | 4.9 kDa |
Gene Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC219935L3 | Lenti-ORF clone of UBE2C (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 6 |
CNY 5,890.00 |
|
RC219935L4 | Lenti-ORF clone of UBE2C (mGFP-tagged)-Human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 6 |
CNY 5,890.00 |
|
RG219935 | UBE2C (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 6 |
CNY 4,370.00 |
|
SC307376 | UBE2C (untagged)-Human ubiquitin-conjugating enzyme E2C (UBE2C), transcript variant 6 |
CNY 3,990.00 |