Macrophage Inflammatory Protein 3 (CCL23) (NM_005064) Human Tagged ORF Clone
CAT#: RC219379
- TrueORF®
CCL23 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8-1
ORF Plasmid: tGFP
"NM_005064" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CK-BETA-8; Ckb-8; Ckb-8-1; CKb8; hmrp-2a; MIP-3; MIP3; MPIF-1; SCYA23 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC219379 representing NM_005064
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGGTCTCCGTGGCTGCCCTCTCCTGCCTCATGCTTGTTACTGCCCTTGGATCCCAGGCCCGGGTCA CAAAAGATGCAGAGACAGAGTTCATGATGTCAAAGCTTCCATTGGAAAATCCAGTACTTCTGGACATGCT CTGGAGGAGAAAGATTGGTCCTCAGATGACCCTTTCTCATGCTGCAGGATTCCATGCTACTAGTGCTGAC TGCTGCATCTCCTACACCCCACGAAGCATCCCGTGTTCACTCCTGGAGAGTTACTTTGAAACGAACAGCG AGTGCTCCAAGCCGGGTGTCATCTTCCTCACCAAGAAGGGGCGACGTTTCTGTGCCAACCCCAGTGATAA GCAAGTTCAGGTTTGCGTGAGAATGCTGAAGCTGGACACACGGATCAAGACCAGGAAGAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC219379 representing NM_005064
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDMLWRRKIGPQMTLSHAAGFHATSAD CCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005064 |
ORF Size | 411 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005064.4 |
RefSeq Size | 641 bp |
RefSeq ORF | 414 bp |
Locus ID | 6368 |
UniProt ID | P55773 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
MW | 15.29 kDa |
Gene Summary | This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC219379L3 | Lenti-ORF clone of CCL23 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8-1 |
CNY 5,890.00 |
|
RC219379L4 | Lenti-ORF clone of CCL23 (mGFP-tagged)-Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8-1 |
CNY 5,890.00 |
|
RG219379 | CCL23 (tGFP-tagged) - Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8-1 |
CNY 4,370.00 |
|
SC303572 | CCL23 (untagged)-Human chemokine (C-C motif) ligand 23 (CCL23), transcript variant CKbeta8-1 |
CNY 3,990.00 |
其它Macrophage Inflammatory Protein 3产品