IL22 RA2 (IL22RA2) (NM_181309) Human Tagged ORF Clone
CAT#: RC219095
IL22RA2 (Myc-DDK-tagged)-Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2
ORF Plasmid: tGFP
"NM_181309" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CRF2-10; CRF2-S1; CRF2X; IL-22BP; IL-22R-alpha-2; IL-22RA2; ZCYTOR16 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC219095 representing NM_181309
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGCCTAAACATTGCTTTCTAGGCTTCCTCATCAGTTTCTTCCTTACTGGTGTAGCAGGAACTCAGT CAACGCATGAGTCTCTGAAGCCTCAGAGGGTACAATTTCAGTCCCGAAATTTTCACAACATTTTGCAATG GCAGCCTGGGAGGGCACTTACTGGCAACAGCAGTGTCTATTTTGTGCAGTACAAAATATATGGACAGAGA CAATGGAAAAATAAAGAAGACTGTTGGGGTACTCAAGAACTCTCTTGTGACCTTACCAGTGAAACCTCAG ACATACAGGAACCTTATTACGGGAGGGTGAGGGCGGCCTCGGCTGGGAGCTACTCAGAATGGAGCATGAC GCCGCGGTTCACTCCCTGGTGGGAAACAAAAATAGATCCTCCAGTCATGAATATAACCCAAGTCAATGGC TCTTTGTTGGTAATTCTCCATGCTCCAAATTTACCATATAGATACCAAAAGGAAAAAAATGTATCTATAG AAGATTACTATGAACTACTATACCGAGTTTTTATAATTAACAATTCACTAGAAAAGGAGCAAAAGGTTTA TGAAGGGGCTCACAGAGCGGTTGAAATTGAAGCTCTAACACCACACTCCAGCTACTGTGTAGTGGCTGAA ATATATCAGCCCATGTTAGACAGAAGAAGTCAGAGAAGTGAAGAGAGATGTGTGGAAATTCCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC219095 representing NM_181309
Red=Cloning site Green=Tags(s) MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQR QWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNG SLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAE IYQPMLDRRSQRSEERCVEIP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_181309 |
ORF Size | 693 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_181309.2 |
RefSeq Size | 2814 bp |
RefSeq ORF | 696 bp |
Locus ID | 116379 |
UniProt ID | Q969J5 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
MW | 26.8 kDa |
Gene Summary | This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
The Rare IL22RA2 Signal Peptide Coding Variant rs28385692 Decreases Secretion of IL-22BP Isoform-1, -2 and -3 and Is Associated with Risk for Multiple Sclerosis
,Gómez-Fernández, P;Lopez de Lapuente Portilla, A;Astobiza, I;Mena, J;Urtasun, A;Altmann, V;Matesanz, F;Otaegui, D;Urcelay, E;Antigüedad, A;Malhotra, S;Montalban, X;Castillo-Triviño, T;Espino-Paisán, L;Aktas, O;Buttmann, M;Chan, A;Fontaine, B;Gourraud, PA;Hecker, M;Hoffjan, S;Kubisch, C;Kümpfel, T;Luessi, F;Zettl, UK;Zipp, F;Alloza, I;Comabella, M;Lill, CM;Vandenbroeck, K;,
Cells
,PubMed ID 31936765
[IL22 RA2]
|
Pharmacological Targeting of the ER-Resident Chaperones GRP94 or Cyclophilin B Induces Secretion of IL-22 Binding Protein Isoform-1 (IL-22BPi1)
,Gómez-Fernández, P;Urtasun, A;Astobiza, I;Mena, J;Alloza, I;Vandenbroeck, K;,
Int J Mol Sci
,PubMed ID 31108847
[IL22 RA2]
|
Long Interleukin-22 Binding Protein Isoform-1 Is an Intracellular Activator of the Unfolded Protein Response
,Gómez-Fernández, P;Urtasun, A;Paton, AW;Paton, JC;Borrego, F;Dersh, D;Argon, Y;Alloza, I;Vandenbroeck, K;,
Front Immunol
,PubMed ID 30619294
[IL22 RA2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC219095L1 | Lenti ORF clone of Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC219095L2 | Lenti ORF clone of Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC219095L3 | Lenti ORF clone of Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC219095L4 | Lenti ORF clone of Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG219095 | IL22RA2 (tGFP-tagged) - Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2 |
CNY 5,200.00 |
|
SC307270 | IL22RA2 (untagged)-Human interleukin 22 receptor, alpha 2 (IL22RA2), transcript variant 2 |
CNY 2,400.00 |
其它IL22 RA2产品